PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G103100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family TALE
Protein Properties Length: 749aa    MW: 78440.8 Da    PI: 6.9244
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G103100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095545911954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Sevir.9G103100.1.p 554 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 591
                         564459******************************88 PP

2BELL120.48.1e-39415485272
                BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia+q+
  Sevir.9G103100.1.p 415 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIASQL 485
                         779******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-70337483IPR006563POX domain
PfamPF075261.9E-53342482IPR006563POX domain
PROSITE profilePS5007112.6532595IPR001356Homeobox domain
SMARTSM003891.6E-9535599IPR001356Homeobox domain
CDDcd000864.21E-13535596No hitNo description
SuperFamilySSF466892.57E-17537602IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28538601IPR009057Homeodomain-like
PfamPF059203.8E-18552591IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MGIAAPSSQP GQTTTYYVSQ PTKSSAAISG RPATASSSMS HSQGFHQGSS GVFGYSSDGF  60
DRPDSSQDHH QQQQQHVAQQ SRRDKLRVQG FDPPGAGAAG HGLLPIDGDE HAEPGAMFEH  120
AAAAGASNML SEMFNFPAPP SGPSATELLA SQMNATNYRF GLRQGVAGLS GDGGWFGAGA  180
AGRAGLVLGG ANMGSLGETS SPKQQGSMAG LATDPAAAMQ LFLMNPQQQQ QQQSRSSPTS  240
PQPSDVQHHE AFQAFGGGGA GGVVEGQGLS LSLSSSLQQL EMAKQAEELR VRDGVLYFNR  300
QQPQGPAVQQ QQLLPMALHG GQVGALGQQL HVGYGPAGVA GVLRNSKYTR AAQELLEEFC  360
SVGRGQIKGG ARGGRGASAS NPNASKGGGA SSSGAAQSPS SASKQEPPQL SPADRFEHQR  420
KKAKLISMLD EVDRRYNHYC DQMQMVVNFF DSVMGFGAAT PYTALAQKAM SRHFRCLKDA  480
IASQLRHTCE LLGEKDAGTS SGLTKGETPR LRAIDQSLRQ QRAFHHMGMM EQEAWRPQRG  540
LPERSVNILR SWLFEHFLHP YPSDADKHLL ARQTGLSRNQ VSNWFINARV RLWKPMIEEM  600
YQQECRELEG SSAGGGGPES GNDPSGADDT HSPTTTGAAQ LQQQQHGTAA PGLMPHKPDP  660
GAAGPSAADA AFVGIDPVEL LGGDAHVGGG ADDLYGRFEP GVRMRYGPGA TGAAAGDVSL  720
TLGLQHAGAG NAGPDGAGRF SLTDYSGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-17541598158Homeobox protein Meis1
4xrs_B2e-17541598158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9575010.0EU957501.1 Zea mays clone 1595427 homeodomain protein JUBEL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-140BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLK4AJL10.0K4AJL1_SETIT; Uncharacterized protein
STRINGSi039082m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-126BEL1-like homeodomain 4